67kDa Laminin Receptor (RPSA) (NM_002295) Human Mass Spec Standard
CAT#: PH309795
RPSA MS Standard C13 and N15-labeled recombinant protein (NP_002286)
View other "67kDa Laminin Receptor" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | RPSA MS Standard C13 and N15-labeled recombinant protein (NP_002286) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209795 |
| Predicted MW | 32.8 kDa |
| Protein Sequence |
>RC209795 protein sequence
Red=Cloning site Green=Tags(s) MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIEN PADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYV NLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEI EKEGQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAP TAQATEWVGATTDWS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002286 |
| RefSeq Size | 1155 |
| RefSeq ORF | 885 |
| Synonyms | 37LRP; 67LR; ICAS; LAMBR; lamR; LAMR1; LBP; LBP/p40; LRP; LRP/LR; NEM/1CHD4; p40; SA |
| Locus ID | 3921 |
| Cytogenetics | 3p22.1 |
| Summary | Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Ribosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400830 | RPSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423324 | RPSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400830 | Transient overexpression lysate of ribosomal protein SA (RPSA), transcript variant 1 |
CNY 3080.00 |
|
| LY423324 | Transient overexpression lysate of ribosomal protein SA (RPSA), transcript variant 2 |
CNY 3080.00 |
|
| PH320075 | RPSA MS Standard C13 and N15-labeled recombinant protein (NP_001012321) |
CNY 19520.00 |
|
| TP309795 | Purified recombinant protein of Homo sapiens ribosomal protein SA (RPSA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP320075 | Recombinant protein of human ribosomal protein SA (RPSA), transcript variant 2, 20 µg |
CNY 2900.00 |
其它67kDa Laminin Receptor产品
