NT5C3 (NT5C3A) (NM_001002009) Human Mass Spec Standard
CAT#: PH309741
NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_001002009)
View other "NT5C3" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_001002009) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209741 |
Predicted MW | 33.9 kDa |
Protein Sequence |
>RC209741 protein sequence
Red=Cloning site Green=Tags(s) MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNI IDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDV MLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHV FNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVL VQDESLEVANSILQKIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001002009 |
RefSeq Size | 1782 |
RefSeq ORF | 891 |
Synonyms | cN-III; hUMP1; NT5C3; P5'N-1; P5N-1; p36; PN-I; POMP; PSN1; UMPH; UMPH1 |
Locus ID | 51251 |
Cytogenetics | 7p14.3 |
Summary | This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. Mutations in this gene are a cause of hemolytic anemia due to uridine 5-prime monophosphate hydrolase deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and pseudogenes of this gene are located on the long arm of chromosomes 3 and 4. [provided by RefSeq, Mar 2012] |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413931 | NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424318 | NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424319 | NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413931 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3 |
CNY 3080.00 |
|
LY424318 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2 |
CNY 3080.00 |
|
LY424319 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1 |
CNY 3080.00 |
|
PH305629 | NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_057573) |
CNY 19520.00 |
|
TP305629 | Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP309741 | Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, 20 µg |
CNY 2900.00 |