CDC26 (NM_139286) Human Mass Spec Standard
CAT#: PH309719
CDC26 MS Standard C13 and N15-labeled recombinant protein (NP_644815)
View other "CDC26" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CDC26 MS Standard C13 and N15-labeled recombinant protein (NP_644815) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209719 |
| Predicted MW | 9.8 kDa |
| Protein Sequence |
>RC209719 protein sequence
Red=Cloning site Green=Tags(s) MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ PKPNNRSSQFGSLEF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_644815 |
| RefSeq Size | 885 |
| RefSeq ORF | 255 |
| Synonyms | ANAPC12; APC12; C9orf17 |
| Locus ID | 246184 |
| Cytogenetics | 9q32 |
| Summary | The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408342 | CDC26 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408342 | Transient overexpression lysate of cell division cycle 26 homolog (S. cerevisiae) (CDC26) |
CNY 3080.00 |
|
| TP309719 | Recombinant protein of human cell division cycle 26 homolog (S. cerevisiae) (CDC26), 20 µg |
CNY 2900.00 |
