p21 ARC (ARPC3) (NM_005719) Human Mass Spec Standard
CAT#: PH309711
ARPC3 MS Standard C13 and N15-labeled recombinant protein (NP_005710)
View other "p21 ARC" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ARPC3 MS Standard C13 and N15-labeled recombinant protein (NP_005710) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209711 |
| Predicted MW | 20.5 kDa |
| Protein Sequence |
>RC209711 protein sequence
Red=Cloning site Green=Tags(s) MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIY ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQET GLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005710 |
| RefSeq Size | 962 |
| RefSeq ORF | 534 |
| Synonyms | ARC21; p21-Arc |
| Locus ID | 10094 |
| Cytogenetics | 12q24.11 |
| Summary | This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013] |
| Protein Pathways | Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401745 | ARPC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401745 | Transient overexpression lysate of actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3) |
CNY 3080.00 |
|
| TP309711 | Recombinant protein of human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), 20 µg |
CNY 2900.00 |
其它p21 ARC产品
