Meis homeobox 3 (MEIS3) (NM_001009813) Human Mass Spec Standard
CAT#: PH309662
MEIS3 MS Standard C13 and N15-labeled recombinant protein (NP_001009813)
View other "Meis homeobox 3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | MEIS3 MS Standard C13 and N15-labeled recombinant protein (NP_001009813) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209662 |
| Predicted MW | 39.1 kDa |
| Protein Sequence |
>RC209662 protein sequence
Red=Cloning site Green=Tags(s) MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLA LVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVL RFHLLELEKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLAS QSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQ LAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLN LEGEWHYL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001009813 |
| RefSeq Size | 1977 |
| RefSeq ORF | 1074 |
| Synonyms | MRG2 |
| Locus ID | 56917 |
| Cytogenetics | 19q13.32 |
| Summary | This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells. [provided by RefSeq, Sep 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412624 | MEIS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422933 | MEIS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412624 | Transient overexpression lysate of Meis homeobox 3 (MEIS3), transcript variant 1 |
CNY 3080.00 |
|
| LY422933 | Transient overexpression lysate of Meis homeobox 3 (MEIS3), transcript variant 2 |
CNY 3080.00 |
|
| PH306100 | MEIS3 MS Standard C13 and N15-labeled recombinant protein (NP_064545) |
CNY 19520.00 |
|
| TP306100 | Recombinant protein of human Meis homeobox 3 (MEIS3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP309662 | Recombinant protein of human Meis homeobox 3 (MEIS3), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Meis homeobox 3产品
