HMBOX1 (NM_024567) Human Mass Spec Standard
CAT#: PH309647
HMBOX1 MS Standard C13 and N15-labeled recombinant protein (NP_078843)
View other "HMBOX1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HMBOX1 MS Standard C13 and N15-labeled recombinant protein (NP_078843) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209647 |
| Predicted MW | 47.3 kDa |
| Protein Sequence |
>RC209647 protein sequence
Red=Cloning site Green=Tags(s) MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGS SYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHAN SMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQG SDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLA VMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILES HGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_078843 |
| RefSeq Size | 3233 |
| RefSeq ORF | 1260 |
| Synonyms | HNF1LA; HOT1; PBHNF; TAH1 |
| Locus ID | 79618 |
| Cytogenetics | 8p21.1-p12 |
| Summary | Binds directly to 5'-TTAGGG-3' repeats in telomeric DNA (PubMed:23813958, PubMed:23685356). Associates with the telomerase complex at sites of active telomere processing and positively regulates telomere elongation (PubMed:23685356). Important for TERT binding to chromatin, indicating a role in recruitment of the telomerase complex to telomeres (By similarity). Also plays a role in the alternative lengthening of telomeres (ALT) pathway in telomerase-negative cells where it promotes formation and/or maintenance of ALT-associated promyelocytic leukemia bodies (APBs) (PubMed:23813958). Enhances formation of telomere C-circles in ALT cells, suggesting a possible role in telomere recombination (PubMed:23813958). Might also be involved in the DNA damage response at telomeres (PubMed:23813958).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411234 | HMBOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427683 | HMBOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411234 | Transient overexpression lysate of homeobox containing 1 (HMBOX1), transcript variant 1 |
CNY 3080.00 |
|
| LY427683 | Transient overexpression lysate of homeobox containing 1 (HMBOX1), transcript variant 2 |
CNY 3080.00 |
|
| TP309647 | Recombinant protein of human homeobox containing 1 (HMBOX1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP761488 | Purified recombinant protein of Human homeobox containing 1 (HMBOX1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2040.00 |
