Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_016291) Human Mass Spec Standard
CAT＃: PH309533
IP6K2 MS Standard C13 and N15-labeled recombinant protein (NP_057375)
View other "Inositol Hexakisphosphate Kinase 2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | IP6K2 MS Standard C13 and N15-labeled recombinant protein (NP_057375) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209533 |
| Predicted MW | 49.3 kDa |
| Protein Sequence |
>RC209533 protein sequence
Red=Cloning site Green=Tags(s) MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVV SVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK MKSHKLEEEFEWLKKSEVLYYTVEKKWNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLT SRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKL SVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI SEESGE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057375 |
| RefSeq Size | 1813 |
| RefSeq ORF | 1278 |
| Synonyms | IHPK2; InsP6K2; PIUS |
| Locus ID | 51447 |
| Cytogenetics | 3p21.31 |
| Summary | This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4 and affect the growth suppressive and apoptotic activities of interferon-beta in some ovarian cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414064 | IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423667 | IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC425158 | IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414064 | Transient overexpression lysate of inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 1 |
CNY 3080.00 |
|
| LY423667 | Transient overexpression lysate of inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 2 |
CNY 4840.00 |
|
| TP309533 | Recombinant protein of human inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760718 | Purified recombinant protein of Human inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它Inositol Hexakisphosphate Kinase 2产品
