ATPBD4 (DPH6) (NM_080650) Human Mass Spec Standard
CAT#: PH309471
ATPBD4 MS Standard C13 and N15-labeled recombinant protein (NP_542381)
View other "ATPBD4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ATPBD4 MS Standard C13 and N15-labeled recombinant protein (NP_542381) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209471 |
| Predicted MW | 30.3 kDa |
| Protein Sequence |
>RC209471 protein sequence
Red=Cloning site Green=Tags(s) MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLY RRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAY LWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTL DCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_542381 |
| RefSeq Size | 2139 |
| RefSeq ORF | 801 |
| Synonyms | ATPBD4 |
| Locus ID | 89978 |
| Cytogenetics | 15q14 |
| Summary | Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. Diphthamide biosynthesis consists in the conversion of an L-histidine residue in the translation elongation factor (EEF2) to diphthamide (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409120 | DPH6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427988 | DPH6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409120 | Transient overexpression lysate of ATP binding domain 4 (ATPBD4), transcript variant 1 |
CNY 3080.00 |
|
| LY427988 | Transient overexpression lysate of ATP binding domain 4 (ATPBD4), transcript variant 2 |
CNY 3080.00 |
|
| TP309471 | Recombinant protein of human ATP binding domain 4 (ATPBD4), transcript variant 1, 20 µg |
CNY 2900.00 |
