DDX47 (NM_016355) Human Mass Spec Standard
CAT#: PH309448
DDX47 MS Standard C13 and N15-labeled recombinant protein (NP_057439)
View other "DDX47" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DDX47 MS Standard C13 and N15-labeled recombinant protein (NP_057439) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209448 |
Predicted MW | 50.6 kDa |
Protein Sequence |
>RC209448 protein sequence
Red=Cloning site Green=Tags(s) MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAET GSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALA KKPHIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTK KVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYIFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTA LLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHR VGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEK KKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057439 |
RefSeq Size | 1836 |
RefSeq ORF | 1365 |
Synonyms | E4-DBP; HQ0256; MSTP162; RRP3 |
Locus ID | 51202 |
Cytogenetics | 12p13.1 |
Summary | This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404586 | DDX47 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414030 | DDX47 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404586 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 (DDX47), transcript variant 2 |
CNY 3080.00 |
|
LY414030 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 (DDX47), transcript variant 1 |
CNY 3080.00 |
|
TP309448 | Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 (DDX47), transcript variant 1, 20 µg |
CNY 2900.00 |