ARL8B (NM_018184) Human Mass Spec Standard
CAT#: PH309368
ARL8B MS Standard C13 and N15-labeled recombinant protein (NP_060654)
View other "ARL8B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ARL8B MS Standard C13 and N15-labeled recombinant protein (NP_060654) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209368 |
| Predicted MW | 21.5 kDa |
| Protein Sequence |
>RC209368 protein sequence
Red=Cloning site Green=Tags(s) MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060654 |
| RefSeq Size | 3008 |
| RefSeq ORF | 558 |
| Synonyms | ARL10C; Gie1 |
| Locus ID | 55207 |
| Cytogenetics | 3p26.1 |
| Summary | Plays a role in lysosome motility (PubMed:16537643, PubMed:25898167). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (By similarity). May play a role in chromosome segregation (PubMed:15331635).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402654 | ARL8B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402654 | Transient overexpression lysate of ADP-ribosylation factor-like 8B (ARL8B) |
CNY 3080.00 |
|
| TP309368 | Recombinant protein of human ADP-ribosylation factor-like 8B (ARL8B), 20 µg |
CNY 2900.00 |
