PIGL (NM_004278) Human Mass Spec Standard
CAT#: PH309339
PIGL MS Standard C13 and N15-labeled recombinant protein (NP_004269)
View other "PIGL" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PIGL MS Standard C13 and N15-labeled recombinant protein (NP_004269) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209339 |
| Predicted MW | 28.5 kDa |
| Protein Sequence |
>RC209339 protein sequence
Red=Cloning site Green=Tags(s) MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHW VYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI NLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFV LNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004269 |
| RefSeq Size | 1163 |
| RefSeq ORF | 756 |
| Synonyms | CHIME |
| Locus ID | 9487 |
| Cytogenetics | 17p11.2 |
| Summary | This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418094 | PIGL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418094 | Transient overexpression lysate of phosphatidylinositol glycan anchor biosynthesis, class L (PIGL) |
CNY 3080.00 |
|
| TP309339 | Recombinant protein of human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL), 20 µg |
CNY 2900.00 |
