FAM3B (NM_058186) Human Mass Spec Standard
CAT#: PH309309
FAM3B MS Standard C13 and N15-labeled recombinant protein (NP_478066)
View other "FAM3B" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FAM3B MS Standard C13 and N15-labeled recombinant protein (NP_478066) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209309 |
| Predicted MW | 26 kDa |
| Protein Sequence |
>RC209309 protein sequence
Red=Cloning site Green=Tags(s) MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCP SDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTK FIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHS DAKNNRYSGWPAEIQIEGCIPKERS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_478066 |
| RefSeq Size | 1384 |
| RefSeq ORF | 705 |
| Synonyms | 2-21; C21orf11; C21orf76; ORF9; PANDER; PRED44 |
| Locus ID | 54097 |
| Cytogenetics | 21q22.3 |
| Summary | Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403301 | FAM3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403719 | FAM3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403301 | Transient overexpression lysate of family with sequence similarity 3, member B (FAM3B), transcript variant 1 |
CNY 3080.00 |
|
| LY403719 | Transient overexpression lysate of family with sequence similarity 3, member B (FAM3B), transcript variant 2 |
CNY 3080.00 |
|
| TP309309 | Recombinant protein of human family with sequence similarity 3, member B (FAM3B), transcript variant 1, 20 µg |
CNY 2900.00 |
