GNG2 (NM_053064) Human Mass Spec Standard
CAT#: PH309299
GNG2 MS Standard C13 and N15-labeled recombinant protein (NP_444292)
View other "GNG2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GNG2 MS Standard C13 and N15-labeled recombinant protein (NP_444292) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209299 |
| Predicted MW | 7.9 kDa |
| Protein Sequence |
>RC209299 protein sequence
Red=Cloning site Green=Tags(s) MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_444292 |
| RefSeq Size | 3903 |
| RefSeq ORF | 213 |
| Locus ID | 54331 |
| Cytogenetics | 14q22.1 |
| Summary | This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Chemokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403285 | GNG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403285 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 2 (GNG2) |
CNY 3080.00 |
|
| TP309299 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 2 (GNG2), 20 µg |
CNY 2900.00 |
