BACH1 (NM_001186) Human Mass Spec Standard
CAT＃: PH309275
BACH1 MS Standard C13 and N15-labeled recombinant protein (NP_001177)
View other "BACH1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
热销推荐CNY 4840.00
Specifications
| Product Data | |
| Description | BACH1 MS Standard C13 and N15-labeled recombinant protein (NP_001177) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209275 |
| Predicted MW | 82 kDa |
| Protein Sequence |
>RC209275 protein sequence
Red=Cloning site Green=Tags(s) MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGE LNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLKFKFLDSTADQQEC PRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRYQGNAKASPPLQDSASQTYESM CLEKDAALALPSLCPKYRKFQKAFGTDRVRTGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCD ESKLAMEPEETKKDPASQCPTEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKP LSGTDVQEKTFGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQE PCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRNDFQSLLKMHKLTPEQLDCIHD IRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLLKERDHILSTLGETKQNLTGLCQKVCKEAAL SQEQIQILAKYSAADCPLSFLISEKDKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQ MSTATSEQAGPAEQCRQSGGISDFCQQMTDKCTTDE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001177 |
| RefSeq Size | 5642 |
| RefSeq ORF | 2208 |
| Synonyms | BACH-1; BTBD24 |
| Locus ID | 571 |
| Cytogenetics | 21q21.3 |
| Summary | This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, May 2009] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400475 | BACH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404144 | BACH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400475 | Transient overexpression lysate of BTB and CNC homology 1, basic leucine zipper transcription factor 1 (BACH1), transcript variant 2 |
CNY 3080.00 |
|
| LY404144 | Transient overexpression lysate of BTB and CNC homology 1, basic leucine zipper transcription factor 1 (BACH1), transcript variant 1 |
CNY 4840.00 |
|
| PH321628 | BACH1 MS Standard C13 and N15-labeled recombinant protein (NP_996749) |
CNY 19520.00 |
|
| TP309275 | Recombinant protein of human BTB and CNC homology 1, basic leucine zipper transcription factor 1 (BACH1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP321628 | Recombinant protein of human BTB and CNC homology 1, basic leucine zipper transcription factor 1 (BACH1), transcript variant 1, 20 µg |
CNY 2900.00 |
