Factor D (CFD) (NM_001928) Human Mass Spec Standard
CAT#: PH309272
CFD MS Standard C13 and N15-labeled recombinant protein (NP_001919)
View other "Factor D" proteins (1)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CFD MS Standard C13 and N15-labeled recombinant protein (NP_001919) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209272 |
| Predicted MW | 27 kDa |
| Protein Sequence |
>RC209272 protein sequence
Red=Cloning site Green=Tags(s) MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLED AADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDR DVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGG PLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001919 |
| RefSeq Size | 1173 |
| RefSeq ORF | 759 |
| Synonyms | ADIPSIN; ADN; DF; PFD |
| Locus ID | 1675 |
| Cytogenetics | 19p13.3 |
| Summary | This gene encodes a member of the S1, or chymotrypsin, family of serine peptidases. This protease catalyzes the cleavage of factor B, the rate-limiting step of the alternative pathway of complement activation. This protein also functions as an adipokine, a cell signaling protein secreted by adipocytes, which regulates insulin secretion in mice. Mutations in this gene underlie complement factor D deficiency, which is associated with recurrent bacterial meningitis infections in human patients. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the mature protease. [provided by RefSeq, Nov 2015] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
| Protein Pathways | Complement and coagulation cascades |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP309272 | Purified recombinant protein of Homo sapiens complement factor D (adipsin) (CFD), 20 µg |
CNY 2900.00 |
其它Factor D产品
