GNAQ (NM_002072) Human Mass Spec Standard
CAT#: PH309199
GNAQ MS Standard C13 and N15-labeled recombinant protein (NP_002063)
View other "GNAQ" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GNAQ MS Standard C13 and N15-labeled recombinant protein (NP_002063) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209199 |
| Predicted MW | 42.1 kDa |
| Protein Sequence |
>RC209199 protein sequence
Red=Cloning site Green=Tags(s) MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDE DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPG IQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQR SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE EKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ LNLKEYNLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002063 |
| RefSeq Size | 6343 |
| RefSeq ORF | 1077 |
| Synonyms | CMC1; G-ALPHA-q; GAQ; SWS |
| Locus ID | 2776 |
| Cytogenetics | 9q21.2 |
| Summary | This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alzheimer's disease, Calcium signaling pathway, Gap junction, GnRH signaling pathway, Huntington's disease, Long-term depression, Long-term potentiation, Melanogenesis, Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400763 | GNAQ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400763 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), q polypeptide (GNAQ) |
CNY 3080.00 |
|
| TP309199 | Recombinant protein of human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 20 µg |
CNY 2900.00 |
