ZADH1 (PTGR2) (NM_152444) Human Mass Spec Standard
CAT＃: PH309182
PTGR2 MS Standard C13 and N15-labeled recombinant protein (NP_689657)
View other "ZADH1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | PTGR2 MS Standard C13 and N15-labeled recombinant protein (NP_689657) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209182 |
| Predicted MW | 38.5 kDa |
| Protein Sequence |
>RC209182 protein sequence
Red=Cloning site Green=Tags(s) MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQL SQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTS LIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKK DNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKER NITRERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEIS L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689657 |
| RefSeq Size | 2610 |
| RefSeq ORF | 1053 |
| Synonyms | HEL-S-298; PGR2; ZADH1 |
| Locus ID | 145482 |
| Cytogenetics | 14q24.3 |
| Summary | This gene encodes an enzyme involved in the metabolism of prostaglandins. The encoded protein catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. This protein may also be involved in regulating activation of the peroxisome proliferator-activated receptor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403472 | PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431866 | PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431867 | PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403472 | Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 1 |
CNY 3080.00 |
|
| LY431866 | Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 2 |
CNY 3080.00 |
|
| LY431867 | Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 3 |
CNY 3080.00 |
|
| TP309182 | Recombinant protein of human prostaglandin reductase 2 (PTGR2), 20 µg |
CNY 2900.00 |
|
| TP328838 | Recombinant protein of human prostaglandin reductase 2 (PTGR2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP328839 | Recombinant protein of human prostaglandin reductase 2 (PTGR2), transcript variant 3, 20 µg |
CNY 2900.00 |
