SSPN (NM_005086) Human Mass Spec Standard
CAT#: PH309123
SSPN MS Standard C13 and N15-labeled recombinant protein (NP_005077)
View other "SSPN" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SSPN MS Standard C13 and N15-labeled recombinant protein (NP_005077) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209123 |
Predicted MW | 26.6 kDa |
Protein Sequence |
>RC209123 protein sequence
Red=Cloning site Green=Tags(s) MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL LACFVMWKHRYQVFYVGVRICSLTASEGPQQKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005077 |
RefSeq Size | 4547 |
RefSeq ORF | 729 |
Synonyms | DAGA5; KRAG; NSPN; SPN1; SPN2 |
Locus ID | 8082 |
Cytogenetics | 12p12.1 |
Summary | This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417535 | SSPN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417535 | Transient overexpression lysate of sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1 |
CNY 3080.00 |
|
PH327888 | SSPN MS Standard C13 and N15-labeled recombinant protein (NP_001129295) |
CNY 14250.00 |
|
TP309123 | Recombinant protein of human sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP327888 | Purified recombinant protein of Homo sapiens sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 2, 20 µg |
CNY 2900.00 |