WDR73 (NM_032856) Human Mass Spec Standard
CAT#: PH309040
WDR73 MS Standard C13 and N15-labeled recombinant protein (NP_116245)
View other "WDR73" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | WDR73 MS Standard C13 and N15-labeled recombinant protein (NP_116245) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209040 |
| Predicted MW | 41.7 kDa |
| Protein Sequence |
>RC209040 protein sequence
Red=Cloning site Green=Tags(s) MDPGDDWLVESLRLYQDFYAFDLSGATRVLEWIDDKGVFVAGYESLKKNEILHLKLPLRLSVKENKGLFP ERDFKVRHGGFSDRSIFDLKHVPHTRLLVTSGLPGCYLQVWQVAEDSDVIKAVSTIAVHEKEESLWPRVA VFSTLAPGVLHGARLRSLQVVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKWA PLENRSPGPGSGGERWCAEVGSWGQGPGPSIASLGSDGRLCLLDPRDLCHPVSSVQCPVSVPSPDPELLR VTWAPGLKNCLAISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWH PCRPRTLLSATNDASLHVWDWVDLCAPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116245 |
| RefSeq Size | 1855 |
| RefSeq ORF | 1134 |
| Synonyms | GAMOS; GAMOS1; HSPC264 |
| Locus ID | 84942 |
| Cytogenetics | 15q25.2 |
| Summary | The protein encoded by this gene is thought to contain multiple WD40 repeats. WD40 repeats are motifs that contain 40-60 amino acids, and usually end with Trp-Asp (WD). This protein is found in the cytoplasm during interphase, but accumulates at the spindle poles and astral microtubules during mitosis. Reduced expression of this gene results in abnormalities in the size and morphology of the nucleus. Mutations in this gene have been associated with Galloway-Mowat syndrome PMID: 25466283), which is a rare autosomal recessive disorder that affects both the central nervous system and kidneys. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409890 | WDR73 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409890 | Transient overexpression lysate of WD repeat domain 73 (WDR73) |
CNY 3080.00 |
|
| TP309040 | Recombinant protein of human WD repeat domain 73 (WDR73), 20 µg |
CNY 2900.00 |
