RBP7 (NM_052960) Human Mass Spec Standard
CAT#: PH309035
RBP7 MS Standard C13 and N15-labeled recombinant protein (NP_443192)
View other "RBP7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RBP7 MS Standard C13 and N15-labeled recombinant protein (NP_443192) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209035 |
| Predicted MW | 15.5 kDa |
| Protein Sequence |
>RC209035 protein sequence
Red=Cloning site Green=Tags(s) MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEE FDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_443192 |
| RefSeq Size | 704 |
| RefSeq ORF | 402 |
| Synonyms | CRABP4; CRBP4; CRBPIV |
| Locus ID | 116362 |
| Cytogenetics | 1p36.22 |
| Summary | The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. [provided by RefSeq, Aug 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409361 | RBP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409361 | Transient overexpression lysate of retinol binding protein 7, cellular (RBP7) |
CNY 3080.00 |
|
| TP309035 | Recombinant protein of human retinol binding protein 7, cellular (RBP7), 20 µg |
CNY 2900.00 |
