GAPT (NM_152687) Human Mass Spec Standard
CAT#: PH309003
GAPT MS Standard C13 and N15-labeled recombinant protein (NP_689900)
View other "GAPT" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | GAPT MS Standard C13 and N15-labeled recombinant protein (NP_689900) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209003 |
| Predicted MW | 17.9 kDa |
| Protein Sequence |
>RC209003 protein sequence
Red=Cloning site Green=Tags(s) MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLR HEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPR PSEVPQDEDIYILPDSY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689900 |
| RefSeq Size | 2216 |
| RefSeq ORF | 471 |
| Synonyms | C5orf29 |
| Locus ID | 202309 |
| Cytogenetics | 5q11.2 |
| Summary | Negatively regulates B-cell proliferation following stimulation through the B-cell receptor. May play an important role in maintenance of marginal zone (MZ) B-cells (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407363 | GAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407363 | Transient overexpression lysate of GRB2-binding adaptor protein, transmembrane (GAPT) |
CNY 3080.00 |
|
| TP309003 | Recombinant protein of human GRB2-binding adaptor protein, transmembrane (GAPT), 20 µg |
CNY 2900.00 |
