CSAG1 (NM_153478) Human Mass Spec Standard
CAT#: PH308990
CSAG1 MS Standard C13 and N15-labeled recombinant protein (NP_705611)
View other "CSAG1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
| Product Data | |
| Description | CSAG1 MS Standard C13 and N15-labeled recombinant protein (NP_705611) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208990 |
| Predicted MW | 8.7 kDa |
| Protein Sequence |
>RC208990 protein sequence
Red=Cloning site Green=Tags(s) MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKE VPGTKGSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_705611 |
| RefSeq Size | 886 |
| RefSeq ORF | 234 |
| Synonyms | CSAGE; CT24.1 |
| Locus ID | 158511 |
| Cytogenetics | Xq28 |
| Summary | This gene encodes a member of a family of tumor antigens. The protein is expressed in chondrosarcomas, but may also be expressed in normal tissues such as testis. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403512 | CSAG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420161 | CSAG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403512 | Transient overexpression lysate of chondrosarcoma associated gene 1 (CSAG1), transcript variant a |
CNY 3080.00 |
|
| LY420161 | Transient overexpression lysate of chondrosarcoma associated gene 1 (CSAG1), transcript variant c |
CNY 3080.00 |
|
| TP308990 | Purified recombinant protein of Homo sapiens chondrosarcoma associated gene 1 (CSAG1), transcript variant a, 20 µg |
CNY 2900.00 |
