Diazepam Binding Inhibitor (DBI) (NM_020548) Human Mass Spec Standard
CAT#: PH308982
DBI MS Standard C13 and N15-labeled recombinant protein (NP_065438)
View other "Diazepam Binding Inhibitor" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | DBI MS Standard C13 and N15-labeled recombinant protein (NP_065438) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208982 |
Predicted MW | 11.8 kDa |
Protein Sequence |
>RC208982 protein sequence
Red=Cloning site Green=Tags(s) MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGK AKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065438 |
RefSeq Size | 745 |
RefSeq ORF | 312 |
Synonyms | ACBD1; ACBP; CCK-RP; EP |
Locus ID | 1622 |
Cytogenetics | 2q14.2 |
Summary | This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412418 | DBI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412418 | Transient overexpression lysate of diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI), transcript variant 1 |
CNY 3080.00 |
|
TP308982 | Recombinant protein of human diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Diazepam Binding Inhibitor产品