ICAM3 (NM_002162) Human Mass Spec Standard
CAT#: PH308919
ICAM3 MS Standard C13 and N15-labeled recombinant protein (NP_002153)
View other "ICAM3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ICAM3 MS Standard C13 and N15-labeled recombinant protein (NP_002153) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208919 |
| Predicted MW | 59.5 kDa |
| Protein Sequence |
>RC208919 protein sequence
Red=Cloning site Green=Tags(s) MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLS KELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQ VEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVNTSAP RQLRTFVLPVTPPRLVAPRFLEVETSWPVDCTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATA TARADQEGAREIVCNVTLGGERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVSCMAGARVQVTLDGVP AAAPGQPAQLQLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTRHV LQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQCQASSSRGKYTLVVVMDIEAGSSHFVPVF VAVLLTLGVVTIVLALMYVFREHQRSGSYHVREESTYLPLTSMQPTEAMGEEPSRAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002153 |
| RefSeq Size | 1796 |
| RefSeq ORF | 1641 |
| Synonyms | CD50; CDW50; ICAM-R |
| Locus ID | 3385 |
| Cytogenetics | 19p13.2 |
| Summary | The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is constitutively and abundantly expressed by all leucocytes and may be the most important ligand for LFA-1 in the initiation of the immune response. It functions not only as an adhesion molecule, but also as a potent signalling molecule. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016] |
| Protein Families | ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs) |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Virion-incorporated PSGL-1 and CD43 inhibit both cell-free infection and transinfection of HIV-1 by preventing virus–cell binding
,null,
Proceedings of the National Academy of Sciences of the United States of America
,PubMed ID 32193343
[ICAM3]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400788 | ICAM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400788 | Transient overexpression lysate of intercellular adhesion molecule 3 (ICAM3) |
CNY 3080.00 |
|
| TP308919 | Recombinant protein of human intercellular adhesion molecule 3 (ICAM3), 20 µg |
CNY 2900.00 |
