GRAP (NM_006613) Human Mass Spec Standard
CAT#: PH308908
GRAP MS Standard C13 and N15-labeled recombinant protein (NP_006604)
View other "GRAP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GRAP MS Standard C13 and N15-labeled recombinant protein (NP_006604) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208908 |
| Predicted MW | 25.3 kDa |
| Protein Sequence |
>RC208908 protein sequence
Red=Cloning site Green=Tags(s) MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSGRISRQLA EEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYRTTTI AKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRS YVQPVHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006604 |
| RefSeq Size | 2089 |
| RefSeq ORF | 651 |
| Synonyms | DFNB114 |
| Locus ID | 10750 |
| Cytogenetics | 17p11.2 |
| Summary | This gene encodes a member of the GRB2/Sem5/Drk family and functions as a cytoplasmic signaling protein which contains an SH2 domain flanked by two SH3 domains. The SH2 domain interacts with ligand-activated receptors for stem cell factor and erythropoietin, and facilitates the formation of a stable complex with the BCR-ABL oncoprotein. This protein also associates with the Ras guanine nucleotide exchange factor SOS1 (son of sevenless homolog 1) through its N-terminal SH3 domain. In general, it couples signals from receptor and cytoplasmic tyrosine kinases to the Ras signaling pathway. [provided by RefSeq, Jul 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416529 | GRAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416529 | Transient overexpression lysate of GRB2-related adaptor protein (GRAP) |
CNY 3080.00 |
|
| TP308908 | Recombinant protein of human GRB2-related adaptor protein (GRAP), 20 µg |
CNY 2900.00 |
