Apolipoprotein CI (APOC1) (NM_001645) Human Mass Spec Standard
CAT#: PH308888
APOC1 MS Standard C13 and N15-labeled recombinant protein (NP_001636)
View other "Apolipoprotein CI" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | APOC1 MS Standard C13 and N15-labeled recombinant protein (NP_001636) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208888 |
Predicted MW | 9.3 kDa |
Protein Sequence |
>RC208888 protein sequence
Red=Cloning site Green=Tags(s) MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSE TFQKVKEKLKIDS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001636 |
RefSeq Size | 464 |
RefSeq ORF | 249 |
Synonyms | Apo-CI; apo-CIB; ApoC-I; apoC-IB |
Locus ID | 341 |
Cytogenetics | 19q13.32 |
Summary | This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419826 | APOC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419826 | Transient overexpression lysate of apolipoprotein C-I (APOC1) |
CNY 3080.00 |
|
TP308888 | Recombinant protein of human apolipoprotein C-I (APOC1), 20 µg |
CNY 2900.00 |
其它Apolipoprotein CI产品