EMG1 (NM_006331) Human Mass Spec Standard
CAT#: PH308885
EMG1 MS Standard C13 and N15-labeled recombinant protein (NP_006322)
View other "EMG1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | EMG1 MS Standard C13 and N15-labeled recombinant protein (NP_006322) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208885 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC208885 protein sequence
Red=Cloning site Green=Tags(s) MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKTYELLNCDKHK SILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSV EYTEKMVSISNYPLSAALTCAKLTTAFEEVWGVI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006322 |
RefSeq Size | 1072 |
RefSeq ORF | 732 |
Synonyms | C2F; Grcc2f; NEP1 |
Locus ID | 10436 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes an essential, conserved eukaryotic protein that methylates pseudouridine in 18S rRNA. The related protein in yeast is a component of the small subunit processome and is essential for biogenesis of the ribosomal 40S subunit. A mutation in this gene has been associated with Bowen-Conradi syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401906 | EMG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401906 | Transient overexpression lysate of EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1) |
CNY 3080.00 |
|
TP308885 | Recombinant protein of human EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1), 20 µg |
CNY 2900.00 |