HBQ1 (NM_005331) Human Mass Spec Standard
CAT#: PH308857
HBQ1 MS Standard C13 and N15-labeled recombinant protein (NP_005322)
View other "HBQ1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HBQ1 MS Standard C13 and N15-labeled recombinant protein (NP_005322) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208857 |
| Predicted MW | 15.5 kDa |
| Protein Sequence |
>RC208857 protein sequence
Red=Cloning site Green=Tags(s) MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLA VERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSE YR TRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005322 |
| RefSeq Size | 653 |
| RefSeq ORF | 426 |
| Synonyms | HBQ |
| Locus ID | 3049 |
| Cytogenetics | 16p13.3 |
| Summary | Theta-globin mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. The theta-1 gene may be expressed very early in embryonic life, perhaps sometime before 5 weeks. Theta-1 is a member of the human alpha-globin gene cluster that involves five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-2 -pseudoalpha-1 - alpha-2 - alpha-1 - theta-1 - 3'. Research supports a transcriptionally active role for the gene and a functional role for the peptide in specific cells, possibly those of early erythroid tissue. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417378 | HBQ1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417378 | Transient overexpression lysate of hemoglobin, theta 1 (HBQ1) |
CNY 3080.00 |
|
| TP308857 | Recombinant protein of human hemoglobin, theta 1 (HBQ1), 20 µg |
CNY 2900.00 |
