C5orf24 (NM_152409) Human Mass Spec Standard
CAT#: PH308835
C5orf24 MS Standard C13 and N15-labeled recombinant protein (NP_689622)
View other "C5orf24" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C5orf24 MS Standard C13 and N15-labeled recombinant protein (NP_689622) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208835 |
| Predicted MW | 20.1 kDa |
| Protein Sequence |
>RC208835 protein sequence
Red=Cloning site Green=Tags(s) MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGR SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGR PPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689622 |
| RefSeq Size | 4896 |
| RefSeq ORF | 564 |
| Locus ID | 134553 |
| Cytogenetics | 5q31.1 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407577 | C5orf24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427625 | C5orf24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407577 | Transient overexpression lysate of chromosome 5 open reading frame 24 (C5orf24), transcript variant 2 |
CNY 3080.00 |
|
| LY427625 | Transient overexpression lysate of chromosome 5 open reading frame 24 (C5orf24), transcript variant 1 |
CNY 3080.00 |
|
| PH326792 | C5orf24 MS Standard C13 and N15-labeled recombinant protein (NP_001129058) |
CNY 19520.00 |
|
| TP308835 | Recombinant protein of human chromosome 5 open reading frame 24 (C5orf24), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326792 | Recombinant protein of human chromosome 5 open reading frame 24 (C5orf24), transcript variant 1, 20 µg |
CNY 2900.00 |
其它C5orf24产品
