ZNF740 (NM_001004304) Human Mass Spec Standard
CAT#: PH308834
ZNF740 MS Standard C13 and N15-labeled recombinant protein (NP_001004304)
View other "ZNF740" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ZNF740 MS Standard C13 and N15-labeled recombinant protein (NP_001004304) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208834 |
| Predicted MW | 21.9 kDa |
| Protein Sequence |
>RC208834 protein sequence
Red=Cloning site Green=Tags(s) MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDDDS LSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHILIHTGEKPFECDICDMRFIQ KYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGCQSKTSDGQFSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001004304 |
| RefSeq Size | 4256 |
| RefSeq ORF | 579 |
| Synonyms | Zfp740 |
| Locus ID | 283337 |
| Cytogenetics | 12q13.13 |
| Summary | May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424081 | ZNF740 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424081 | Transient overexpression lysate of zinc finger protein 740 (ZNF740) |
CNY 3080.00 |
|
| TP308834 | Recombinant protein of human zinc finger protein 740 (ZNF740), 20 µg |
CNY 2900.00 |
|
| TP761505 | Purified recombinant protein of Human zinc finger protein 740 (ZNF740), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
