CSP (DNAJC5) (NM_025219) Human Mass Spec Standard
CAT#: PH308826
DNAJC5 MS Standard C13 and N15-labeled recombinant protein (NP_079495)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DNAJC5 MS Standard C13 and N15-labeled recombinant protein (NP_079495) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208826 |
| Predicted MW | 22 kDa |
| Protein Sequence |
>RC208826 representing NM_025219
Red=Cloning site Green=Tags(s) MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKA PEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079495 |
| RefSeq Size | 3286 |
| RefSeq ORF | 594 |
| Synonyms | CLN4; CLN4B; CSP; DNAJC5A; mir-941-2; mir-941-3; mir-941-4; mir-941-5; NCL |
| Locus ID | 80331 |
| Cytogenetics | 20q13.33 |
| Summary | This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. The encoded protein plays a role in membrane trafficking and protein folding, and has been shown to have anti-neurodegenerative properties. The encoded protein is known to play a role in cystic fibrosis and Huntington's disease. A pseudogene of this gene is located on the short arm of chromosome 8. [provided by RefSeq, Nov 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410833 | DNAJC5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410833 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) |
CNY 3080.00 |
|
| TP308826 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), 20 µg |
CNY 2900.00 |
