NRARP (NM_001004354) Human Mass Spec Standard
CAT#: PH308806
NRARP MS Standard C13 and N15-labeled recombinant protein (NP_001004354)
View other "NRARP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NRARP MS Standard C13 and N15-labeled recombinant protein (NP_001004354) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208806 |
Predicted MW | 12.5 kDa |
Protein Sequence |
>RC208806 protein sequence
Red=Cloning site Green=Tags(s) MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLL VKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001004354 |
RefSeq Size | 2639 |
RefSeq ORF | 342 |
Locus ID | 441478 |
Cytogenetics | 9q34.3 |
Summary | Downstream effector of Notch signaling. Involved in the regulation of liver cancer cells self-renewal (PubMed:25985737). Involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. Proposed to integrate endothelial Notch and Wnt signaling to control stalk cell proliferation and to stablilize new endothelial connections during angiogenesis (PubMed:19154719). During somitogenesis involved in maintenance of proper somite segmentation and proper numbers of somites and vertebrae. Required for proper anterior-posterior somite patterning. Proposed to function in a negative feedback loop to destabilize Notch 1 intracellular domain (NICD) and downregulate the Notch signal, preventing expansion of the Notch signal into the anterior somite domain (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423743 | NRARP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423743 | Transient overexpression lysate of NOTCH-regulated ankyrin repeat protein (NRARP) |
CNY 3080.00 |
|
TP308806 | Recombinant protein of human NOTCH-regulated ankyrin repeat protein (NRARP), 20 µg |
CNY 2900.00 |