IL1RAP (NM_134470) Human Mass Spec Standard
CAT#: PH308786
IL1RAP MS Standard C13 and N15-labeled recombinant protein (NP_608273)
View other "IL1RAP" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | IL1RAP MS Standard C13 and N15-labeled recombinant protein (NP_608273) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208786 |
Predicted MW | 41 kDa |
Protein Sequence |
>RC208786 protein sequence
Red=Cloning site Green=Tags(s) MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIW YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNY TCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEV WWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQK GNRCGQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_608273 |
RefSeq Size | 2114 |
RefSeq ORF | 1068 |
Synonyms | C3orf13; IL-1RAcP; IL1R3 |
Locus ID | 3556 |
Cytogenetics | 3q28 |
Summary | This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differing in their C-terminus. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. [provided by RefSeq, Jul 2018] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Apoptosis, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400791 | IL1RAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC408731 | IL1RAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433294 | IL1RAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400791 | Transient overexpression lysate of interleukin 1 receptor accessory protein (IL1RAP), transcript variant 1 |
CNY 4,840.00 |
|
LY408731 | Transient overexpression lysate of interleukin 1 receptor accessory protein (IL1RAP), transcript variant 2 |
CNY 3,080.00 |
|
LY433294 | Transient overexpression lysate of interleukin 1 receptor accessory protein (IL1RAP), transcript variant 3 |
CNY 3,080.00 |
|
TP308786 | Recombinant protein of human interleukin 1 receptor accessory protein (IL1RAP), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720670 | Purified recombinant protein of Human interleukin 1 receptor accessory protein (IL1RAP), transcript variant 2 |
CNY 3,710.00 |