MID1 (NM_000381) Human Mass Spec Standard
CAT#: PH308776
MID1 MS Standard C13 and N15-labeled recombinant protein (NP_000372)
View other "MID1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | MID1 MS Standard C13 and N15-labeled recombinant protein (NP_000372) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208776 |
| Predicted MW | 75.3 kDa |
| Protein Sequence |
>RC208776 protein sequence
Red=Cloning site Green=Tags(s) METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCRHVITLSQRGL DGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQFCDQDPAQDAVKTCVTCEVS YCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVA ALSERYDKLKQNLESNLTNLIKRNTELETLLAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQII GTKIKEGKVMRLRKLAQQIANCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLI PEINLNDTFDTFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLKTNSQPFKLDP KSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGRHYWEVVISGSTWYAIGLAYK SAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPHLRRVGILLDYDNGSIAFYDALNSIHLYTFD VAFAQPVCPTFTVWNKCLTIITGLPIPDHLDCTEQLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000372 |
| RefSeq Size | 6463 |
| RefSeq ORF | 2001 |
| Synonyms | BBBG1; FXY; GBBB1; MIDIN; OGS1; OS; OSX; RNF59; TRIM18; XPRF; ZNFXY |
| Locus ID | 4281 |
| Cytogenetics | Xp22.2 |
| Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also known as the 'RING-B box-coiled coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein forms homodimers which associate with microtubules in the cytoplasm. The protein is likely involved in the formation of multiprotein structures acting as anchor points to microtubules. Mutations in this gene have been associated with the X-linked form of Opitz syndrome, which is characterized by midline abnormalities such as cleft lip, laryngeal cleft, heart defects, hypospadias, and agenesis of the corpus callosum. This gene was also the first example of a gene subject to X inactivation in human while escaping it in mouse. Alternative promoter use, alternative splicing and alternative polyadenylation result in multiple transcript variants that have different tissue specificities. [provided by RefSeq, Dec 2016] |
| Protein Families | Druggable Genome |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409610 | MID1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420647 | MID1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424750 | MID1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409610 | Transient overexpression lysate of midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 3 |
CNY 3080.00 |
|
| LY420647 | Transient overexpression lysate of midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 4 |
CNY 4840.00 |
|
| LY424750 | Transient overexpression lysate of midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 1 |
CNY 3080.00 |
|
| PH311781 | MID1 MS Standard C13 and N15-labeled recombinant protein (NP_150632) |
CNY 19520.00 |
|
| PH313454 | MID1 MS Standard C13 and N15-labeled recombinant protein (NP_001092094) |
CNY 19520.00 |
|
| TP308776 | Purified recombinant protein of Homo sapiens midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP311781 | Recombinant protein of human midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP313454 | Recombinant protein of human midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 4, 20 µg |
CNY 2900.00 |
