NUDT10 (NM_153183) Human Mass Spec Standard
CAT#: PH308717
NUDT10 MS Standard C13 and N15-labeled recombinant protein (NP_694853)
View other "NUDT10" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | NUDT10 MS Standard C13 and N15-labeled recombinant protein (NP_694853) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208717 |
Predicted MW | 18.5 kDa |
Protein Sequence |
>RC208717 protein sequence
Red=Cloning site Green=Tags(s) MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA GVKGKLGRLLGVFEQNQDPEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL EKLKLGGSPTNGNSMAPSSPDSDP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_694853 |
RefSeq Size | 2018 |
RefSeq ORF | 492 |
Synonyms | APS2; DIPP3-alpha; DIPP3a |
Locus ID | 170685 |
Cytogenetics | Xp11.22 |
Summary | This gene is a member of the nudix (nucleoside diphosphate linked moiety X)-type motif containing family. The encoded protein is a phosphohydrolase and may regulate the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to the regulation of intracellular trafficking. In some populations putative prostate cancer susceptibility alleles have been identified for this gene. Alternatively spliced transcript variants, which differ only in the 5' UTR, have been found for this gene. [provided by RefSeq, Feb 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407127 | NUDT10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407127 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 10 (NUDT10) |
CNY 3080.00 |
|
TP308717 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 10 (NUDT10), 20 µg |
CNY 2900.00 |