POLR1H (NM_170783) Human Mass Spec Standard
CAT#: PH308651
ZNRD1 MS Standard C13 and N15-labeled recombinant protein (NP_740753)
View other "POLR1H" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ZNRD1 MS Standard C13 and N15-labeled recombinant protein (NP_740753) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208651 |
| Predicted MW | 13.9 kDa |
| Protein Sequence |
>RC208651 protein sequence
Red=Cloning site Green=Tags(s) MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_740753 |
| RefSeq Size | 885 |
| RefSeq ORF | 378 |
| Synonyms | A12.2; HTEX-6; HTEX6; hZR14; Rpa12; tctex-6; TCTEX6; TEX6; ZNRD1; ZR14 |
| Locus ID | 30834 |
| Cytogenetics | 6p22.1 |
| Summary | This gene encodes a DNA-directed RNA polymerase I subunit. The encoded protein contains two potential zinc-binding motifs and may play a role in regulation of cell proliferation. The encoded protein may be involved in cancer and human immunodeficiency virus progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Transcription Factors |
| Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406880 | ZNRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415176 | ZNRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406880 | Transient overexpression lysate of zinc ribbon domain containing 1 (ZNRD1), transcript variant a |
CNY 3080.00 |
|
| LY415176 | Transient overexpression lysate of zinc ribbon domain containing 1 (ZNRD1), transcript variant b |
CNY 3080.00 |
|
| TP308651 | Recombinant protein of human zinc ribbon domain containing 1 (ZNRD1), transcript variant a, 20 µg |
CNY 2900.00 |
