SRC (NM_005417) Human Mass Spec Standard
CAT＃: PH308622
SRC MS Standard C13 and N15-labeled recombinant protein (NP_005408)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
热销推荐Specifications
| Product Data | |
| Description | SRC MS Standard C13 and N15-labeled recombinant protein (NP_005408) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208622 |
| Predicted MW | 59.7 kDa |
| Protein Sequence |
>RC208622 representing NM_005417
Red=Cloning site Green=Tags(s) MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSS DTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYV APSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKL DSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGC FGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC PESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005408 |
| RefSeq Size | 4145 |
| RefSeq ORF | 1608 |
| Synonyms | ASV; c-SRC; p60-Src; SRC1; THC6 |
| Locus ID | 6714 |
| Cytogenetics | 20q11.23 |
| Summary | This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Stem cell relevant signaling - JAK/STAT signaling pathway |
| Protein Pathways | Adherens junction, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, Gap junction, GnRH signaling pathway, Tight junction, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405010 | SRC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417311 | SRC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405010 | Transient overexpression lysate of v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 2 |
CNY 3080.00 |
|
| LY417311 | Transient overexpression lysate of v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1 |
CNY 3080.00 |
|
| PH311858 | SRC MS Standard C13 and N15-labeled recombinant protein (NP_938033) |
CNY 19520.00 |
|
| TP308622 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP311858 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP710015 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), with N-terminal polyhistidine tag, expressed in sf9 cells. |
CNY 4020.00 |
|
| TP710026 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC),with C-terminal polyhistidine tag, expressed in sf9 cells. |
CNY 4020.00 |
Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC),with C-terminal polyhistidine tag, expressed in sf9 cells.
