GATA2 (NM_032638) Human Mass Spec Standard
CAT#: PH308554
GATA2 MS Standard C13 and N15-labeled recombinant protein (NP_116027)
View other "GATA2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GATA2 MS Standard C13 and N15-labeled recombinant protein (NP_116027) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208554 |
| Predicted MW | 50.5 kDa |
| Protein Sequence |
>RC208554 protein sequence
Red=Cloning site Green=Tags(s) MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARV SYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSV YPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDG VKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTP KQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCA NCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116027 |
| RefSeq Size | 3383 |
| RefSeq ORF | 1440 |
| Synonyms | DCML; IMD21; MONOMAC; NFE1B |
| Locus ID | 2624 |
| Cytogenetics | 3q21.3 |
| Summary | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
| Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403182 | GATA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428960 | GATA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403182 | Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 2 |
CNY 3080.00 |
|
| LY428960 | Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 1 |
CNY 3080.00 |
|
| TP308554 | Recombinant protein of human GATA binding protein 2 (GATA2), transcript variant 2, 20 µg |
CNY 2900.00 |
