HE4 (WFDC2) (NM_006103) Human Mass Spec Standard
CAT#: PH308491
WFDC2 MS Standard C13 and N15-labeled recombinant protein (NP_006094)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | WFDC2 MS Standard C13 and N15-labeled recombinant protein (NP_006094) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208491 |
Predicted MW | 13 kDa |
Protein Sequence |
>RC208491 protein sequence
Red=Cloning site Green=Tags(s) MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006094 |
RefSeq Size | 570 |
RefSeq ORF | 372 |
Synonyms | dJ461P17.6; EDDM4; HE4; WAP5 |
Locus ID | 10406 |
Cytogenetics | 20q13.12 |
Summary | This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416866 | WFDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416866 | Transient overexpression lysate of WAP four-disulfide core domain 2 (WFDC2) |
CNY 3080.00 |
|
TP308491 | Recombinant protein of human WAP four-disulfide core domain 2 (WFDC2), 20 µg |
CNY 2900.00 |
|
TP750124 | Purified recombinant protein of Human WAP four-disulfide core domain 2 (HE4), N-terminal Trx-HIS tag, expressed in E. coli, 50ug |
CNY 2000.00 |