PFDN3 (VBP1) (NM_003372) Human Mass Spec Standard
CAT#: PH308482
VBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003363)
View other "PFDN3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | VBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003363) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208482 |
| Predicted MW | 22.6 kDa |
| Protein Sequence |
>RC208482 protein sequence
Red=Cloning site Green=Tags(s) MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQK KRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEA QALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003363 |
| RefSeq Size | 1643 |
| RefSeq ORF | 591 |
| Synonyms | HIBBJ46; PFD3; PFDN3; VBP-1 |
| Locus ID | 7411 |
| Cytogenetics | Xq28 |
| Summary | The protein encoded by this gene interacts with the Von Hippel-Lindau protein to form an intracellular complex. The encoded protein functions as a chaperone protein, and may play a role in the transport of the Von Hippel-Lindau protein from the perinuclear granules to the nucleus or cytoplasm. Alternative splicing and the use of alternate transcription start sites results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Jan 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418727 | VBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418727 | Transient overexpression lysate of von Hippel-Lindau binding protein 1 (VBP1) |
CNY 3080.00 |
|
| TP308482 | Recombinant protein of human von Hippel-Lindau binding protein 1 (VBP1), 20 µg |
CNY 2900.00 |
