FBXO4 (NM_012176) Human Mass Spec Standard
CAT#: PH308458
FBXO4 MS Standard C13 and N15-labeled recombinant protein (NP_036308)
View other "FBXO4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FBXO4 MS Standard C13 and N15-labeled recombinant protein (NP_036308) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208458 |
Predicted MW | 44.1 kDa |
Protein Sequence |
>RC208458 protein sequence
Red=Cloning site Green=Tags(s) MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLTRLPIDVQLYI LSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVTDGAFFDYM AVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLP QRQIDGIGSGVNFQLNNQHKFNILILYSTTRKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQ KVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHL NLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRAR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036308 |
RefSeq Size | 1523 |
RefSeq ORF | 1161 |
Synonyms | FBX4 |
Locus ID | 26272 |
Cytogenetics | 5p13.1 |
Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402159 | FBXO4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402159 | Transient overexpression lysate of F-box protein 4 (FBXO4), transcript variant 1 |
CNY 3080.00 |
|
TP308458 | Recombinant protein of human F-box protein 4 (FBXO4), transcript variant 1, 20 µg |
CNY 2900.00 |