DHFRL1 (DHFR2) (NM_176815) Human Mass Spec Standard
CAT#: PH308452
DHFRL1 MS Standard C13 and N15-labeled recombinant protein (NP_789785)
View other "DHFRL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | DHFRL1 MS Standard C13 and N15-labeled recombinant protein (NP_789785) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208452 |
| Predicted MW | 21.6 kDa |
| Protein Sequence |
>RC208452 protein sequence
Red=Cloning site Green=Tags(s) MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_789785 |
| RefSeq Size | 3934 |
| RefSeq ORF | 561 |
| Synonyms | DHFRL1; DHFRP4 |
| Locus ID | 200895 |
| Cytogenetics | 3q11.2 |
| Summary | Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406051 | DHFRL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406051 | Transient overexpression lysate of dihydrofolate reductase-like 1 (DHFRL1) |
CNY 3080.00 |
|
| TP308452 | Recombinant protein of human dihydrofolate reductase-like 1 (DHFRL1), 20 µg |
CNY 2900.00 |
