IFTAP (NM_138787) Human Mass Spec Standard
CAT#: PH308417
C11orf74 MS Standard C13 and N15-labeled recombinant protein (NP_620142)
View other "IFTAP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C11orf74 MS Standard C13 and N15-labeled recombinant protein (NP_620142) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208417 |
| Predicted MW | 25.4 kDa |
| Protein Sequence |
>RC208417 protein sequence
Red=Cloning site Green=Tags(s) MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVT HKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCI PFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRK DTSPDLEKSCD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_620142 |
| RefSeq Size | 911 |
| RefSeq ORF | 663 |
| Synonyms | C11orf74; HEPIS; NWC |
| Locus ID | 119710 |
| Cytogenetics | 11p12 |
| Summary | This gene encodes a protein that was identified as a cellular interacting partner of non-structural protein 10 of the severe acute respiratory syndrome coronavirus (SARS-CoV). The encoded protein may function as a negative regulator of transcription. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408524 | C11orf74 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408524 | Transient overexpression lysate of chromosome 11 open reading frame 74 (C11orf74) |
CNY 3080.00 |
|
| TP308417 | Recombinant protein of human chromosome 11 open reading frame 74 (C11orf74), 20 µg |
CNY 2900.00 |
