LXR beta (NR1H2) (NM_007121) Human Mass Spec Standard
CAT#: PH308381
NR1H2 MS Standard C13 and N15-labeled recombinant protein (NP_009052)
View other "LXR beta" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | NR1H2 MS Standard C13 and N15-labeled recombinant protein (NP_009052) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC208381 | 
| Predicted MW | 51.1 kDa | 
| Protein Sequence | 
                 >RC208381 protein sequence 
Red=Cloning site Green=Tags(s) MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPE RKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRK CQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQ GSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQ EIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFI NPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_009052 | 
| RefSeq Size | 2093 | 
| RefSeq ORF | 1383 | 
| Synonyms | LXR-b; LXRB; NER; NER-I; RIP15; UNR | 
| Locus ID | 7376 | 
| Cytogenetics | 19q13.33 | 
| Summary | The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).[supplied by OMIM, Jan 2010] | 
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402093 | NR1H2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY402093 | Transient overexpression lysate of nuclear receptor subfamily 1, group H, member 2 (NR1H2) | 
                                                     CNY 3080.00  | 
                                            |
| TP308381 | Recombinant protein of human nuclear receptor subfamily 1, group H, member 2 (NR1H2), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它LXR beta产品
