NAA40 (NM_024771) Human Mass Spec Standard
CAT#: PH308314
NAA40 MS Standard C13 and N15-labeled recombinant protein (NP_079047)
View other "NAA40" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NAA40 MS Standard C13 and N15-labeled recombinant protein (NP_079047) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208314 |
| Predicted MW | 27.2 kDa |
| Protein Sequence |
>RC208314 protein sequence
Red=Cloning site Green=Tags(s) MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATV DWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEV QLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCS YEILSRRTKFGDSHHSHAGGHCGGCCH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079047 |
| RefSeq Size | 3681 |
| RefSeq ORF | 711 |
| Synonyms | hNatD; NAT11; NatD; PATT1 |
| Locus ID | 79829 |
| Cytogenetics | 11q13.1 |
| Summary | N-alpha-acetyltransferase that specifically mediates the acetylation of the N-terminal residues of histones H4 and H2A (PubMed:21935442, PubMed:25619998). In contrast to other N-alpha-acetyltransferase, has a very specific selectivity for histones H4 and H2A N-terminus and specifically recognizes the 'Ser-Gly-Arg-Gly sequence' (PubMed:21935442, PubMed:25619998). Acts as a negative regulator of apoptosis (PubMed:26666750). May play a role in hepatic lipid metabolism (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411083 | NAA40 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411083 | Transient overexpression lysate of N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) (NAA40) |
CNY 3080.00 |
|
| TP308314 | Recombinant protein of human N-acetyltransferase 11 (GCN5-related, putative) (NAT11), 20 µg |
CNY 2900.00 |
