SARS2 (NM_017827) Human Mass Spec Standard
CAT#: PH308306
SARS2 MS Standard C13 and N15-labeled recombinant protein (NP_060297)
View other "SARS2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SARS2 MS Standard C13 and N15-labeled recombinant protein (NP_060297) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208306 |
| Predicted MW | 58.3 kDa |
| Protein Sequence |
>RC208306 protein sequence
Red=Cloning site Green=Tags(s) MAASMARRLWPLLTRRGFRPRGGCISNDSPRRSFTTEKRNRNLLYEYAREGYSALPQLDIERFCACPEEA AHALELRKGELRSADLPAIISTWQELRQLQEQIRSLEEEKAAVTEAVRALLANQDSGEVQQDPKYQGLRA RGREIRKELVHLYPREAQLEEQFYLQALKLPNQTHPDVPVGDESQARVLHMVGDKPVFSFQPRGHLEIGE KLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANP SQIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTK VEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVT SASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRI TAPTHVPLQYIGPNQPRKPGLPGQPAVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060297 |
| RefSeq Size | 2077 |
| RefSeq ORF | 1554 |
| Synonyms | mtSerRS; SARS; SARSM; SerRS; SerRSmt; SERS; SYS |
| Locus ID | 54938 |
| Cytogenetics | 19q13.2 |
| Summary | This gene encodes the mitochondrial seryl-tRNA synthethase precursor, a member of the class II tRNA synthetase family. The mature enzyme catalyzes the ligation of Serine to tRNA(Ser) and participates in the biosynthesis of selenocysteinyl-tRNA(sec) in mitochondria. The enzyme contains an N-terminal tRNA binding domain and a core catalytic domain. It functions in a homodimeric form, which is stabilized by tRNA binding. This gene is regulated by a bidirectional promoter that also controls the expression of mitochondrial ribosomal protein S12. Both genes are within the critical interval for the autosomal dominant deafness locus DFNA4 and might be linked to this disease. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Mar 2009] |
| Protein Pathways | Aminoacyl-tRNA biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413512 | SARS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431453 | SARS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413512 | Transient overexpression lysate of seryl-tRNA synthetase 2, mitochondrial (SARS2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| LY431453 | Transient overexpression lysate of seryl-tRNA synthetase 2, mitochondrial (SARS2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| TP308306 | Recombinant protein of human seryl-tRNA synthetase 2, mitochondrial (SARS2), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
