COA5 (NM_001008215) Human Mass Spec Standard
CAT#: PH308299
C2orf64 MS Standard C13 and N15-labeled recombinant protein (NP_001008216)
View other "COA5" proteins (1)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C2orf64 MS Standard C13 and N15-labeled recombinant protein (NP_001008216) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208299 |
| Predicted MW | 8.4 kDa |
| Protein Sequence |
>RC208299 protein sequence
Red=Cloning site Green=Tags(s) MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRG RKGY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001008216 |
| RefSeq Size | 1767 |
| RefSeq ORF | 222 |
| Synonyms | 6330578E17Rik; C2orf64; CEMCOX3; MC4DN9; Pet191 |
| Locus ID | 493753 |
| Cytogenetics | 2q11.2 |
| Summary | This gene encodes an ortholog of yeast Pet191, which in yeast is a subunit of a large oligomeric complex associated with the mitochondrial inner membrane, and required for the assembly of the cytochrome c oxidase complex. Mutations in this gene are associated with mitochondrial complex IV deficiency, a disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to a severe disease affecting several tissues and organs. [provided by RefSeq, Dec 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP308299 | Recombinant protein of human chromosome 2 open reading frame 64 (C2orf64), 20 µg |
CNY 2900.00 |
