KCNIP1 (NM_014592) Human Mass Spec Standard
CAT#: PH308255
KCNIP1 MS Standard C13 and N15-labeled recombinant protein (NP_055407)
View other "KCNIP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | KCNIP1 MS Standard C13 and N15-labeled recombinant protein (NP_055407) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208255 |
Predicted MW | 25.2 kDa |
Protein Sequence |
>RC208255 protein sequence
Red=Cloning site Green=Tags(s) MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVN EDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDG YINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQ LFQNVM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055407 |
RefSeq Size | 2028 |
RefSeq ORF | 648 |
Synonyms | KCHIP1; VABP |
Locus ID | 30820 |
Cytogenetics | 5q35.1 |
Summary | This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subunits to form native Kv4 channel complexes. The encoded protein may regulate rapidly inactivating (A-type) currents, and hence neuronal membrane excitability, in response to changes in the concentration of intracellular calcium. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415191 | KCNIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415191 | Transient overexpression lysate of Kv channel interacting protein 1 (KCNIP1), transcript variant 2 |
CNY 3080.00 |
|
TP308255 | Recombinant protein of human Kv channel interacting protein 1 (KCNIP1), transcript variant 2, 20 µg |
CNY 2900.00 |