TMEM17 (NM_198276) Human Mass Spec Standard
CAT#: PH308232
TMEM17 MS Standard C13 and N15-labeled recombinant protein (NP_938017)
View other "TMEM17" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TMEM17 MS Standard C13 and N15-labeled recombinant protein (NP_938017) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208232 |
| Predicted MW | 23.1 kDa |
| Protein Sequence |
>RC208232 protein sequence
Red=Cloning site Green=Tags(s) MELPDPVRQRLGNFSRAVFSDSNRTSPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYS ILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLE KAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_938017 |
| RefSeq Size | 1925 |
| RefSeq ORF | 594 |
| Locus ID | 200728 |
| Cytogenetics | 2p15 |
| Summary | Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405002 | TMEM17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405002 | Transient overexpression lysate of transmembrane protein 17 (TMEM17) |
CNY 3080.00 |
|
| TP308232 | Recombinant protein of human transmembrane protein 17 (TMEM17), 20 µg |
CNY 2900.00 |
