RNF11 (NM_014372) Human Mass Spec Standard
CAT#: PH308220
RNF11 MS Standard C13 and N15-labeled recombinant protein (NP_055187)
View other "RNF11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RNF11 MS Standard C13 and N15-labeled recombinant protein (NP_055187) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208220 |
| Predicted MW | 17.4 kDa |
| Protein Sequence |
>RC208220 protein sequence
Red=Cloning site Green=Tags(s) MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRI AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCM EPVDAALLSSYETN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055187 |
| RefSeq Size | 3082 |
| RefSeq ORF | 462 |
| Synonyms | CGI-123; SID1669 |
| Locus ID | 26994 |
| Cytogenetics | 1p32.3 |
| Summary | The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN). [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402321 | RNF11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402321 | Transient overexpression lysate of ring finger protein 11 (RNF11) |
CNY 3080.00 |
|
| TP308220 | Recombinant protein of human ring finger protein 11 (RNF11), 20 µg |
CNY 2900.00 |
